PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 560aa    MW: 61314.9 Da    PI: 6.3113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009464.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.2e-163378147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd  l ++v  +G ++W++Iar ++ gR++k+c++rw + 
      Pbr009464.1 33 RGPWSPEEDAVLSRLVGNFGARNWSLIARGIP-GRSGKSCRLRWCNQ 78
                     89******************************.***********985 PP

2Myb_DNA-binding52.51.1e-1685129147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++++eEd ++v a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
      Pbr009464.1  85 RKPFSEEEDHIIVSAHAIHGNK-WAVIAKLLP-GRTDNGIKNHWNST 129
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5093079IPR017930Myb domain
SuperFamilySSF466892.21E-2930126IPR009057Homeodomain-like
SMARTSM007172.2E-133281IPR001005SANT/Myb domain
PfamPF002493.0E-153378IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-253486IPR009057Homeodomain-like
CDDcd001671.48E-123577No hitNo description
PROSITE profilePS5129424.70280134IPR017930Myb domain
SMARTSM007174.2E-1484132IPR001005SANT/Myb domain
PfamPF002499.0E-1585129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2287133IPR009057Homeodomain-like
CDDcd001672.53E-1087130No hitNo description
PROSITE profilePS5129219.018428494IPR011016Zinc finger, RING-CH-type
Gene3DG3DSA:3.30.40.101.0E-14432489IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF578503.04E-9433490No hitNo description
SMARTSM007448.8E-18435488IPR011016Zinc finger, RING-CH-type
PfamPF129063.1E-9436487IPR011016Zinc finger, RING-CH-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MTAPNDAVPK EADDRPGTEA ELNEGAVPGG KVRGPWSPEE DAVLSRLVGN FGARNWSLIA  60
RGIPGRSGKS CRLRWCNQLD PCVKRKPFSE EEDHIIVSAH AIHGNKWAVI AKLLPGRTDN  120
GIKNHWNSTL RRKCFDKGRF NTGHGEMMED DTFDRKNASS EETLSVGNIS SFKTHEGREV  180
LMENRPNQFD VRNHAKEGSG AAESKHNSTL IAESSDHPTL QSTTCRPVAR VSAFSVYNRP  240
SGPANASSFS RTVPSHGPLV PITKLDFGFD NFLDGACNEP MVPQRCGHSC CDRVKGHSQS  300
SLLGPEFVEY DEPLPFSSHE LISIATDLNK IAWIKSGLES NGIRMPESVA SQRVFQAAAT  360
TLQMGLPANT PMNDHMCFEE GRNKLMGMMT DVLSTQRCST ESGFEIVERE SSASESSVEV  420
DLEEVKMHVA KVERDCRICH LSMDATNHES GIPIELGCSC KADLAAAHKQ CAEAWFKIKG  480
NKTCEICGST ARNVSGLSEA ESAEQWHDEA ALAAAVAGAP VQTPESRNFW QGHRFLNFLL  540
ACMVFAFVIS WLFHFNVPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-37321336107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0164900.0EF016490.1 Malus x domestica cultivar Royal Gala Myb transcription factor (MYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009344337.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0FK200.0A0FK20_MALDO; MYB domain class transcription factor
STRINGVIT_13s0019g03200.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-97myb domain protein 109